Chengdu YoungShe Chemical Co., Ltd


  • Total 2 Related Items
  • Compnay Name:Chengdu YoungShe Chemical Co., Ltd
  • Membership: Free Member
  • Registration Date:2017.09.15
  • Country/Region :China  
  • Address :6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone Chengdu, Sichuan
  • Phone / Fax :86-181-08235634 / 86-028-62328193
  • Contact:Cecilia Jiang  
Contact Now* Send an Inquiry to this supplier.
  • Share to :
  • Pinterest

Contact us

Chengdu YoungShe Chemical Co., Ltd

SichuanChengdu6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone
Contact name
Cecilia Jiang


FOX 04DRI / Senolytics

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Package 1g for one bottle

Send an Inquiry to this supplier

Send an Inquiry to this supplier
* From
  To Cecilia Jiang
Chengdu YoungShe Chemical Co., Ltd
* Buying Product
- Please enter your specific buying item.
e.g. 42 inch LCD TV, leather executive chair
Category : Pharmaceutical Intermediates
* Message

Use English only Max. 2000 characters. (Min. 20)

Send does not guarantee the validity of product information or the credentials of sellers.